PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10026036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family BES1
Protein Properties Length: 307aa    MW: 32832.7 Da    PI: 9.4827
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10026036genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822203.94.8e-6371471145
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                  g+sgr p+wkErEnn rRERrRRaiaakiy+GLR+qGn+klpk++DnneVlkALc+eAGw+ve+DGttyrkg+kpl   e+ag+  s s  ss+q s+
  Lus10026036   7 GSSGRLPSWKERENNMRRERRRRAIAAKIYTGLRSQGNFKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGCKPL-PGEIAGTPLSFSGGSSIQPSP 103
                  689*************************************************************************.********************* PP

       DUF822  99 kssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                  ++s+++spv sy+asp+sssfpsps+++ +++a    llp+l++ ++
  Lus10026036 104 QTSNFQSPVISYQASPTSSSFPSPSRFEANPSA---YLLPLLRNIAS 147
                  ****************************99885...78888887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.0E-598132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009741Biological Processresponse to brassinosteroid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MTGGGGGSSG RLPSWKEREN NMRRERRRRA IAAKIYTGLR SQGNFKLPKH CDNNEVLKAL  60
CAEAGWIVEE DGTTYRKGCK PLPGEIAGTP LSFSGGSSIQ PSPQTSNFQS PVISYQASPT  120
SSSFPSPSRF EANPSAYLLP LLRNIASIPP NLPPLRISNS APVTPPLSSP TRTSNASSLA  180
NNASIVNSFN HQIFAASAPS SPARRHHYFQ PIPECDESDG SIIDSGGWLS FQGVPSSQTI  240
PVSPTFNLVR PMVGVKVNAA ASGADNVRSS EFEFENRKVK PWEGERIHEM GADDLELTLA  300
SGKARG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383240.11e-118hypothetical protein POPTR_0005s12790g
SwissprotQ8S3071e-102BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLB9MXS01e-118B9MXS0_POPTR; Uncharacterized protein
STRINGPOPTR_0005s12790.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-95BES1 family protein